PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G40130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 208aa    MW: 23291.6 Da    PI: 10.9674
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G40130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.74.7e-212067249
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     rie++  rqv fskRr+g +KKA+ELS+LC a+v  ++fs+ gk y +
  LPERR01G40130.1 20 RIESEEARQVCFSKRRAGFFKKASELSILCSADVVAVVFSPAGKAYSF 67
                     8*******************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.8481171IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.18E-261183IPR002100Transcription factor, MADS-box
SMARTSM004324.7E-301170IPR002100Transcription factor, MADS-box
CDDcd002651.17E-361283No hitNo description
PRINTSPR004041.3E-191333IPR002100Transcription factor, MADS-box
PfamPF003191.6E-242067IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-193348IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-194869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MVVPARRRPS LGRQKIEIRR IESEEARQVC FSKRRAGFFK KASELSILCS ADVVAVVFSP  60
AGKAYSFGHP SVDYLLERFM GPNTGNNNND TSRPGVQVRR GRMVDKLNRQ YGEVRAVVEA  120
QRARQETLDE LMDRERAARS RPAAWIDADV AHMSAEELVA FGARLMAVQD GVVARADQML  180
RDALLIGRPP TNTNSRARGG GFFHLHHF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057891e-75AP005789.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0563F09.
GenBankAP0058841e-75AP005884.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0598D02.
GenBankAP0149651e-75AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126171e-75CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640475.12e-86PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLA0A0D9VAY31e-152A0A0D9VAY3_9ORYZ; Uncharacterized protein
STRINGBGIOSGA005284-PA8e-86(Oryza sativa Indica Group)
STRINGLOC_Os01g74440.18e-86(Oryza sativa Japonica Group)
STRINGORGLA01G0394900.18e-86(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65360.11e-28AGAMOUS-like 23